Glucagon NEW
| Price | Get Latest Price | ||
| Package | 100g | 500g | 1000g |
| Min. Order: | 1g |
| Supply Ability: | 100000tons |
| Update Time: | 2023-11-03 |
Product Details
| Product Name: Glucagon | CAS No.: 16941-32-5 |
| EC-No.: 685-611-6 | Min. Order: 1g |
| Purity: 99% | Supply Ability: 100000tons |
| Release date: 2023/11/03 |
-Product Description-
Our company has a variety of high-quality pharmaceutical intermediates, 100% Quality Guarantee.
If you are interested in us, please feel free to contact me:WhatsApp/Skype/Telegram:+86 15621811730.
| Product Name: | Glucagon |
| Synonyms: | GLUCAGON 1-37;GLUCAGON (1-37) (PORCINE);GLUCAGON 37;GLUCAGON ACETATE;HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA;H-HIS-SER-GLN-GLY-THR-PHE-THR-SER-ASP-TYR-SER-LYS-TYR-LEU-ASP-SER-ARG-ARG-ALA-GLN-ASP-PHE-VAL-GLN-TRP-LEU-MET-ASN-THR-LYS-ARG-ASN-LYS-ASN-ASN-ILE-ALA-OH;Glucagon 1-29;Glucagon(1-29) Human HCl |
| CAS: | 16941-32-5 |
| MF: | C153H225N43O49S |
| MW: | 3482.75 |
| EINECS: | 685-611-6 |
| Product Categories: | Amino Acid Derivatives;Peptide;GlucagonIslet Stem Cell Biology;Islet Stem Cell Differentiation;Hormones;Other Protein/Peptide Hormones;Glucagon and Glucagon-Like PeptidesPeptides for Cell Biology;GlucagonsIslet Stem Cell Biology;Cytokines Growth Factors and Hormones (Obesity);Gastrointestinal Peptides;GlucagonObesity Research;API;Diabetes Research;16941-32-5 |
| Mol File: | 16941-32-5.mol |
-Company Introduction-
We are Anhui Zhongda Biotechnology Co., Ltd., mainly engaged in pharmaceutical intermediates and various chemicals. It is one of the most dynamic foreign trade companies in the Chinese market. We have a pharmaceutical raw material production workshop and a reagent research and development center. Now has the most complete production line. In addition, we also have custom synthesis of various organic compounds as supplements. We can synthesize almost any chemical.
We always insist on survival by quality and development by reputation.
If you have any products you need, please feel free to contact me.
Hope to establish relations with you!
-Hot Selling Products-
-Packaging & Shipping-
Shipping method: FedEx, DHL, UPS, TNT, Postal Express.
We have a professional customs clearance team, you don't need to worry about any customs issues.We will be responsible for customs clearance taxes and other issues. Professional transportation, convenient and safe, 100% door-to-door delivery. If anything happens to your package, we promise to reship it for free. Enjoy the second free reissue policy.
Looking forward to cooperating with you, our high-quality products and thoughtful service will definitely make you satisfied!
Company Profile Introduction
You may like
![|Met-Enkephalin |[MET5]](https://img.chemicalbook.com/ProductImageEN/2023-08/Large/b71157e0-f791-49f1-b75b-3eb602a80015.jpg)
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $250.00/10mg |
VIP3Y
|
TargetMol Chemicals Inc.
|
2024-10-30 | |
| $30.00/1kg |
VIP1Y
|
Shandong Deshang Chemical Co., Ltd.
|
2024-07-10 | |
| $22.00/1box |
VIP1Y
|
Shanghai Getian Industrial Co., LTD
|
2024-05-11 | |
| $0.00/1g |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-15 | |
| $30.00/1box |
VIP1Y
|
hebei hongtan Biotechnology Co., Ltd
|
2024-03-20 | |
| $10.00/1kg |
Nantong Guangyuan Chemicl Co,Ltd
|
2023-11-14 | ||
| $70.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-02 | |
| $40.00/50BOX |
Shanghai Chinqesen Biotechnology Co., Ltd.
|
2023-10-31 | ||
| $20.00/1g |
Shanghai Yunao International Trade Co., Ltd
|
2023-10-11 | ||
| $99.00/1kg |
Anhui Ruihan Technology Co., Ltd
|
2023-08-17 |
China- Since: 2023-06-08
- Address: No. 1858, Chuangxin Avenue, High-tech Zone, Hefei City, Anhui Province