Dulaglutide NEW
| Price | $50 |
| Package | 1g |
| Min. Order: | 1g |
| Supply Ability: | 500t |
| Update Time: | 2023-10-12 |
Product Details
| Product Name: Dulaglutide | CAS No.: 923950-08-7 |
| Min. Order: 1g | Purity: 99% |
| Supply Ability: 500t | Release date: 2023/10/12 |
| Common Name | Dulaglutide | ||
|---|---|---|---|
| CAS Number | 923950-08-7 | Molecular Weight | 3314.62 |
| Density | 1.4±0.1 g/cm3 | Boiling Point | N/A |
| Molecular Formula | C149H221N37O49 | Melting Point | N/A |
| MSDS | N/A | Flash Point | N/A |
Use of Dulaglutide
Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG.
1kg/aluminum foil bag or 25kg/drum
1.1kg-10kg packing: 2 P.E. bag inside + 1 foil bag outside
2. 15kg packing: 2 P.E. bag inside + 1 foil bag outside in carton
3. 25kg-50kg packing: 2 P.E. bag inside + 1 foil bag outside in drum
4. Customized packing
Shipping:
1) By Express: EMS/ DHL/ FedEx/ TNT/ UPS for sample or small order
2) By air or Sea for bulk order
Our Services
1) The professional sales reprensentative answers your inquiy on time;
2) We can provide reasonable price, high quality product and prompt shipmen;
3) We can send the goods to your delivery addreee directly, it is relatively safe and fast;
4) Warm sfter sale service, we will help to solve the problems in your usage.
whatsapp/signal/telegram;+8617621705551
wickr:luckymeng588
Company Profile Introduction
You may like
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $0.00/1box |
VIP1Y
|
Shandong Huizhihan Supply Chain Co., Ltd
|
2024-11-08 | |
| $10.00/1kg |
VIP4Y
|
Hebei Chuanghai Biotechnology Co,.LTD
|
2024-08-09 | |
| $0.00/1box |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-17 | |
| $0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-03 | |
| $75.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-27 | |
| $10.00/1kg |
Nantong Guangyuan Chemicl Co,Ltd
|
2023-11-15 | ||
| $55.00/1g |
VIP2Y
|
Wuhan Quanjinci New Material Co.,Ltd.
|
2023-11-02 | |
| $12.36/1G |
Wuhan Han Sheng New Material Technology Co.，Ltd
|
2023-10-27 | ||
| $40.00/1kg |
Shanghai Chinqesen Biotechnology Co., Ltd.
|
2023-10-27 | ||
| $1.00/1g |
VIP2Y
|
Wuhan Cell Pharmaceutical Co., Ltd
|
2023-09-07 |
China- Since: 2020-08-12
- Address: Shanghai city
+86-17621705551
asdf@shanghaihg.cn