Dulaglutide NEW
| Price | $10 | $6 | $2 |
| Package | 1KG | 100KG | 1000KG |
| Min. Order: | 1KG |
| Supply Ability: | g-kg-tons, free sample is available |
| Update Time: | 2025-01-08 |
Product Details
| Product Name: Dulaglutide | CAS No.: 923950-08-7 |
| Min. Order: 1KG | Purity: 99% |
| Supply Ability: g-kg-tons, free sample is available | Release date: 2025/01/08 |
| Lead time: In stock | Packaging: bottle/drum/bucket/IBC, as request. |
| Delivery: By sea, by air, by express | Origin: Manufacturer |
1. Product information
| Name | Dulaglutide |
|---|---|
| Synonym | More Synonyms |
| Description | Dulaglutide (LY2189265) is a glucagon-like peptide-1 (GLP-1) receptor agonist. Sequence: His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Glu-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Gly-Gly;HGEGTFTSDVSSYLEEQAAKEFIAWLVKGGG. |
|---|---|
| Related Catalog | Signaling Pathways >> GPCR/G Protein >> Glucagon Receptor Research Areas >> Metabolic Disease Peptides |
| Target | GLP-1 receptor[1] |
| In Vivo | Dulaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist. No specific Dulaglutide-related cause of death is identified. Survival is numerically increased for both genders of animals in all Dulaglutide treatment groups and reaches statistical significance (P≤0.05) in the 0.5- and 5-mg/kg males and in the 0.05-, 0.5-, and 1.5-mg/kg females. Mean times to peak plasma concentration values of Dulaglutide are observed at 12 hours after dosing on day 1 and rang between 12 and 48 hours at week 52. The incidence of thyroid C-cell adenoma is significantly (P≤0.05) increased compare with controls in males and females at the Dulaglutide 0.5-, 1.5-, and 5-mg/kg doses[1]. |
| Animal Admin | The tumorigenic potential of Dulaglutide is evaluated in rats and transgenic mice. Rats are injected sc twice weekly for 93 weeks with Dulaglutide 0, 0.05, 0.5, 1.5, or 5 mg/kg corresponding to 0, 0.5, 7, 20, and 58 times, respectively. Transgenic mice are dosed sc twice weekly with Dulaglutide 0, 0.3, 1, or 3 mg/kg for 26 weeks[1]. |
| References | [1]. Byrd RA, et al. Chronic Toxicity and Carcinogenicity Studies of the Long-Acting GLP-1 Receptor AgonistDulaglutide in Rodents. Endocrinology. 2015 Jul;156(7):2417-28. |
| Density | 1.4±0.1 g/cm3 |
|---|---|
| Molecular Formula | C149H221N37O49 |
| Molecular Weight | 3314.62 |
| LogP | 3.81 |
| Index of Refraction | 1.706 |
| Storage condition | -20°C |
2. Packaging
For powders: normal is 25kgs/Drum or bag, or larger/smaller package as request.
For liquids: normal 25kgs/drum, 180-300kgs/bucket, or IBC, determined by the nature of the product.
Or smaller package 1kg/bottle, 10kgs/bottle as request.
3. Shipping
4. Contact information
For more details, pls contact us freely.
Mob: 86 17630971917
WhatsApp/Skype/Wechat/LINE: 86 17630971917
Company Profile Introduction
Henan Fengda Chemical Co., Ltd. is located in the High-tech Development Zone of Henan Province. Specializing in the production and sales of various fine chemical products required for industrial production, including chemical raw materials, organic raw materials, petrochemicals, chemical reagents, solvents, catalysts, and additives, etc.
You may like
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $0.00/1kg |
VIP1Y
|
Fuzhou Lista Biotechnology Co.,Ltd
|
2024-12-26 | |
| $0.00/1Box |
VIP1Y
|
American HealthyMorph LLC
|
2024-12-26 | |
| $0.00/1BOX |
VIP1Y
|
Shandong Huizhihan Supply Chain Co., Ltd
|
2024-11-12 | |
| $10.00/1kg |
VIP4Y
|
Hebei Chuanghai Biotechnology Co,.LTD
|
2024-08-09 | |
| $0.00/1box |
VIP1Y
|
Shaanxi TNJONE Pharmaceutical Co., Ltd
|
2024-04-17 | |
| $0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-03 | |
| $75.00/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2023-11-27 | |
| $10.00/1kg |
Nantong Guangyuan Chemicl Co,Ltd
|
2023-11-15 | ||
| $55.00/1g |
VIP2Y
|
Wuhan Quanjinci New Material Co.,Ltd.
|
2023-11-02 | |
| $12.36/1G |
Wuhan Han Sheng New Material Technology Co.，Ltd
|
2023-10-27 |
China
- Since: 2023-02-10
- Address: Room 01, 2288 E05, Building 14, East Henan University, Science and Technology Park, 279 Xisanhuan Ro
INQUIRY