成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

ChemicalBook--->CAS DataBase List--->863288-34-0

863288-34-0

863288-34-0 Structure

863288-34-0 Structure
IdentificationBack Directory
[Name]

CJC1295
[CAS]

863288-34-0
[Synonyms]

CJC1295
----------
CJC-1295(2MG)
CJC-1295(10mg)
CJC-1295 Acetate
CJC-1295 CJC-1295
CJC1295 with out DAC
CJC1295 No DAC acetate
CJC-1295 Acetate without DAC
Peptides Bodybuilding cjc-1295
CJC-1295 Without DAC 86328-34-0
Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
Human Growth Peptide Cjc 1295 with Dac/Cjc 1295 Without Dac 2mg/Vials
L-Tyrosyl-D-alanyl-L-α-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-allothreonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-leucyl-L-seryl-L-alanyl
L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6-[3-(2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl)-1-oxopropyl]-L-lysinamide
[EINECS(EC#)]

206-141-6
[Molecular Formula]

C152H252N44O42
[MOL File]

863288-34-0.mol
[Molecular Weight]

3367.9
Chemical PropertiesBack Directory
[Melting point ]

> 177° C (dec.)
[density ]

1.45
[storage temp. ]

-20°C Freezer, Under inert atmosphere
[solubility ]

Ethanol (Slightly, Heated, Sonicated), Methanol (Slightly), Water (Slightly)
[form ]

Solid
[color ]

White to Off-White
[InChIKey]

XOZMWINMZMMOBR-HRDSVTNWSA-N
Hazard InformationBack Directory
[Description]

CJC-1295 is an incredibly effective growth hormone and works by causing another substance to be secreted. It stimulates the release of your own body’s growth hormone which. Research show that after the age of 30 the body’s growth hormone level drops quickly and approximately 15% every 10 years. CJC-1295 is able to increase growth hormone naturally by binding to receptors for growth hormone releasing hormone (GHRH) on your brain and more specifically the pituitary gland. 
[Uses]

CJC 1295 Acetate is used in application of growth hormone releasing hormone agonist to preparing anti-aging agent.
[Pharmacology]

By doing this it triggers the brain to release growth hormone that would have otherwise been lost with age. Research completed with healthy men and women between the ages of 21 and 61, showed that CJC-1295 had the ability to  increase serum growth hormone levels by 200-1000%. In these individuals, the elevated growth hormone production and release continued for up to 6 days because CJC-1295 has a half life of about 6-8 days. This longer half-life means the body continues to produces beyond the day of injection and is thought to be a great benefit has compared to other peptides that also have similar actions. For this reason and a few more, CJC-1295 has become very effective peptide for safely increasing growth hormone levels.
[Clinical Use]

CJC 1295 allows the anterior pituitary to follow the natural, pulsatile release of growth hormone without an increase in appetite stimulation, cortisol, acetylcholine, prolactin, and aldosterone. Typically, you will see CJC compounded with Ipamorelin due to its ability to stimulate GHRH for enhanced results.Increased GH secretion and IFG-1 levels;Increased muscle growth;Increased bone density;Improved cognitive function and memory;Increased cellular repair and regeneration;Increased fat loss;Taken before bed to maximize the natural cycle of growth hormone.
[Side effects]

CJC-1295 is safely biologically increased growth hormone levels without the side of effects of other medication such hGH treatment which have been none to have more side effects. Some of the side effects of CJC-1295 are generally mild and tend to not last long if at all such as headache, flushing, and dizziness. The most common reported side effect is redness and irritation at the injection site.
863288-34-0 suppliers list
Company Name: Hebei Xunou new energy Technology Co., LTD
Tel: +86-17531957005; +undefined17531957005 , +undefined17531957005
Website: http://www.is0513.com/manufacturer/hebei-xunou-new-energy-technology-25201/
Company Name: Shanghai Longyu Biotechnology Co., Ltd.
Tel: +8619521488211 , +8619521488211
Website: www.is0513.com/manufacturer/shanghai-longyu-biotechnology-164/
Company Name: Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
Tel: +86-519-85525359 +86-15995072465 , +86-15995072465
Website: www.xuanmingchem.com
Company Name: Zhuzhou Yaozhijie Chemical Co., LTD
Tel: +8618073316972 , +8618073316972
Website: https://www.steroidpep.com/
Company Name: Hebei Jiafan Trading Company Limited
Tel: +8615354498258 , +8615354498258
Website:
Company Name: Wuhan Godbullraw Chemical Co.,ltd
Tel: +undefined18986288449 , +undefined18986288449
Website: http://www.is0513.com/ShowSupplierProductsList1024161/0_EN.htm
Company Name: Hebei Nafu Technology Co. , Ltd.
Tel: +8615075022224 , +8615075022224
Website: www.is0513.com/ShowSupplierProductsList344003/0.htm
Company Name: Hubei Lange Biotechnology Co., Ltd.
Tel: +8617762501948 , +8617762501948
Website: www.is0513.com/ShowSupplierProductsList435547/0.htm
Company Name: Hebei Yinsheng Technology Co., Ltd.
Tel: +86-17331136691 , +86-17331136691
Website: www.is0513.com/ShowSupplierProductsList1426583/0.htm
Company Name: Hebei Gongyuan New Material Technology Co., Ltd.
Tel: +8617331136198 , +8617331136198
Website: www.is0513.com/ShowSupplierProductsList424335/0.htm
Company Name: Wuhan Cell Pharmaceutical Co., Ltd
Tel: +86-13129979210 +86-13129979210 , +86-13129979210
Website:
Company Name: Hebei Mujin Biotechnology Co.,Ltd
Tel: +86 13288715578 +8613288715578 , +8613288715578
Website: http://www.mojinchemical.com
Company Name: Zhejiang Hangyu API Co., Ltd
Tel: +8617531972939 , +8617531972939
Website: www.api-made.com
Company Name: Henan Bao Enluo International TradeCo.,LTD
Tel: +86-17331933971 +86-17331933971 , +86-17331933971
Website: baoenluo.guidechem.com/
Company Name: Xiamen Wonderful Bio Technology Co., Ltd.
Tel: +8613043004613 , +8613043004613
Website: www.chinabmkpmk.com/
Company Name: qingdao future trading Co., Ltd
Tel: +86-13335044410 +86-13335044410 , +86-13335044410
Website: www.redlionpharm.com
Company Name: Shandong Huisheng Import & Export Co., Ltd.
Tel: +86-13176845580 +86-13176845580 , +86-13176845580
Website: www.is0513.com/manufacturer/shandong-huisheng-import-export-25188/
Company Name: Anhui Zhongda Biotechnology Co., Ltd
Tel: +8619956560829 , +8619956560829
Website:
Tags:863288-34-0 Related Product Information
158861-67-7 50-56-6 120287-85-6 304853-26-7 7719-12-2 76-05-1 7320-34-5 624-49-7 104-55-2 1313-82-2 56-87-1 57982-77-1 121062-08-6 137525-51-0 75921-69-6 170851-70-4 51110-01-1 140703-51-1