成人免费xx,国产又黄又湿又刺激不卡网站,成人性视频app菠萝网站,色天天天天

Welcome to chemicalbook!
400-158-6606
Inquriy
Try our best to find the right business for you.
Do not miss inquiry messages Please log in to view all inquiry messages.

Welcome back!

ChemicalBook >> CAS DataBase List >> Teriparatide acetate

Teriparatide acetate

Teriparatide acetate price.
  • $88 - $5690
  • Product name: Teriparatide acetate
  • CAS: 52232-67-4
  • MF: C172H278N52O47S2
  • MW: 3890.49792
  • EINECS:640-978-1
  • MDL Number:MFCD00149013
  • Synonyms:PARATHYROID HORMONE HUMAN: FRAGMENT 1-34;PARATHYROID HORMONE (HUMAN, 1-34);PARATHYROID HORMONE (1-34), HUMAN;PTH (HUMAN, 1-34);Teriparatide acetate;SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE;SER-VAL-SER-GLU-ILE-GLN-LEU-MET-HIS-ASN-LEU-GLY-LYS-HIS-LEU-ASN-SER-MET-GLU-ARG-VAL-GLU-TRP-LEU-ARG-LYS-LYS-LEU-GLN-ASP-VAL-HIS-ASN-PHE HUMAN
24 prices
Selected condition：
Brand
  • Alfa Aesar
  • American Custom Chemicals Corporation
  • ApexBio Technology
  • Chemenu
  • Crysdot
  • Medical Isotopes, Inc.
  • Sigma-Aldrich
  • Tocris
  • TRC
Package
  • 1
  • 23-5501-1mg
  • 0.1mg
  • 0.5mg
  • 1mg
  • 5mg
  • 10mg
  • 25mg
  • Y0001916
  • 50mg
  • 100mg
  • ManufacturerAlfa Aesar
  • Product numberJ66180
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging0.5mg
  • Price$148
  • Updated2021-12-16
  • Buy
  • ManufacturerAlfa Aesar
  • Product numberJ66180
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging1mg
  • Price$259
  • Updated2023-06-20
  • Buy
  • ManufacturerAmerican Custom Chemicals Corporation
  • Product numberSHG0006488
  • Product descriptionPARATHYROID HORMONE (1-34) 95.00%
  • Packaging1MG
  • Price$883.11
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging1mg
  • Price$88
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging5mg
  • Price$132
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging10mg
  • Price$167
  • Updated2021-12-16
  • Buy
  • ManufacturerApexBio Technology
  • Product numberA1129
  • Product descriptionParathyroid Hormone (1-34), human
  • Packaging25mg
  • Price$375
  • Updated2021-12-16
  • Buy
  • ManufacturerChemenu
  • Product numberCM101690
  • Product descriptionTeriparatide 97%
  • Packaging50mg
  • Price$290
  • Updated2021-12-16
  • Buy
  • ManufacturerChemenu
  • Product numberCM101690
  • Product descriptionTeriparatide 97%
  • Packaging100mg
  • Price$561
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging5mg
  • Price$99
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging10mg
  • Price$149
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging25mg
  • Price$248
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging50mg
  • Price$396
  • Updated2021-12-16
  • Buy
  • ManufacturerCrysdot
  • Product numberCD00003640
  • Product descriptionTeriparatideAcetate 97%
  • Packaging100mg
  • Price$594
  • Updated2021-12-16
  • Buy
  • ManufacturerMedical Isotopes, Inc.
  • Product number17715
  • Product descriptionTeriparatide
  • Packaging25mg
  • Price$5690
  • Updated2021-12-16
  • Buy
  • ManufacturerSigma-Aldrich
  • Product numberP3796
  • Product descriptionParathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder
  • Packaging0.1mg
  • Price$178
  • Updated2024-03-01
  • Buy
Manufacturer Product number Product description Packaging Price Updated Buy
Alfa Aesar J66180 Parathyroid Hormone (1-34), human 0.5mg $148 2021-12-16 Buy
Alfa Aesar J66180 Parathyroid Hormone (1-34), human 1mg $259 2023-06-20 Buy
American Custom Chemicals Corporation SHG0006488 PARATHYROID HORMONE (1-34) 95.00% 1MG $883.11 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 1mg $88 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 5mg $132 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 10mg $167 2021-12-16 Buy
ApexBio Technology A1129 Parathyroid Hormone (1-34), human 25mg $375 2021-12-16 Buy
Chemenu CM101690 Teriparatide 97% 50mg $290 2021-12-16 Buy
Chemenu CM101690 Teriparatide 97% 100mg $561 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 5mg $99 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 10mg $149 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 25mg $248 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 50mg $396 2021-12-16 Buy
Crysdot CD00003640 TeriparatideAcetate 97% 100mg $594 2021-12-16 Buy
Medical Isotopes, Inc. 17715 Teriparatide 25mg $5690 2021-12-16 Buy
Sigma-Aldrich P3796 Parathyroid Hormone Fragment 1-34 human ≥95% (HPLC), powder 0.1mg $178 2024-03-01 Buy

Properties

Melting point :>205oC (dec.)
RTECS :SQ7770000
storage temp. :−20°C
solubility :DMSO (Slightly), Water (Slightly)
form :powder
color :White to Off-White
Water Solubility :Soluble to 0.40 mg/ml in water
Sequence :H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Stability :Hygroscopic
CAS DataBase Reference :52232-67-4(CAS DataBase Reference)

Safety Information

Symbol(GHS): GHS hazard pictograms
Signal word: Warning
Hazard statements:
Code Hazard statements Hazard class Category Signal word Pictogram P-Codes
H227 Combustible liquid Flammable liquids Category 4 Warning P210, P280, P370+P378, P403+P235,P501
H302 Harmful if swallowed Acute toxicity,oral Category 4 Warning GHS hazard pictograms P264, P270, P301+P312, P330, P501
Precautionary statements:
P210 Keep away from heat/sparks/open flames/hot surfaces. — No smoking.
P264 Wash hands thoroughly after handling.
P264 Wash skin thouroughly after handling.
P270 Do not eat, drink or smoke when using this product.
P280 Wear protective gloves/protective clothing/eye protection/face protection.
P301+P312 IF SWALLOWED: call a POISON CENTER or doctor/physician IF you feel unwell.
P330 Rinse mouth.
P370+P378 In case of fire: Use … for extinction.
P403+P235 Store in a well-ventilated place. Keep cool.
P501 Dispose of contents/container to..…

Description

A fragment of human parathyroid hormone (hPTH) peptide sequence containing the 34 N-terminal residues of hPTH. This fragment was also found to be an agonist at PTH1 and PTH2 receptors.

Related product price