GRF (1-44) (HUMAN)
|
- $180 - $1445
- Product name: GRF (1-44) (HUMAN)
- CAS: 83930-13-6
- MF: C215H358N72O66S
- MW: 5039.65082
- EINECS:
- MDL Number:MFCD00081671
- Synonyms:SERMORELIN (HUMAN);SOMATOCRININ (HUMAN);SOMATOLIBERIN (HUMAN);SOMATORELIN;YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-GLN-GLN-GLY-GLU-SER-ASN-GLN-GLU-ARG-GLY-ALA-ARG-ALA-ARG-LEU-NH2;GRF (huMan) SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin;SoMatoliberin (huMan), SoMatocrinin (huMan), SoMatorelin (huMan), Growth HorMone-Releasing Factor (huMan), Growth HorMone-Releasing HorMone (huMan), GHRH (huMan), SoMatorelin
11 prices
Selected condition：
Brand
- Biorbyt Ltd
- ChemScene
- DC Chemicals
- Usbiological
Package
- 10ug
- 250ug
- 500ug
- 1mg
- 5mg
- 10mg
- ManufacturerBiorbyt Ltd
- Product numberorb611697
- Product descriptionGRF (1-44), human
- Packaging1mg
- Price$368.9
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611697
- Product descriptionGRF (1-44), human
- Packaging5mg
- Price$935
- Updated2021-12-16
- Buy
- ManufacturerBiorbyt Ltd
- Product numberorb611697
- Product descriptionGRF (1-44), human
- Packaging10mg
- Price$1445
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-5901
- Product descriptionHumangrowthhormone-releasingfactor
- Packaging500ug
- Price$180
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-5901
- Product descriptionHumangrowthhormone-releasingfactor
- Packaging1mg
- Price$264
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-5901
- Product descriptionHumangrowthhormone-releasingfactor
- Packaging5mg
- Price$924
- Updated2021-12-16
- Buy
- ManufacturerChemScene
- Product numberCS-5901
- Product descriptionHumangrowthhormone-releasingfactor
- Packaging10mg
- Price$1440
- Updated2021-12-16
- Buy
- ManufacturerDC Chemicals
- Product numberDC23916
- Product descriptionGRF(1-44),human >98%
- Packaging10mg
- Price$550
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number208929
- Product descriptionGrowth Hormone Releasing Hormone, Human
- Packaging250ug
- Price$559
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number154928
- Product descriptionGrowth Hormone Releasing Hormone
- Packaging10ug
- Price$320
- Updated2021-12-16
- Buy
- ManufacturerUsbiological
- Product number154929
- Product descriptionGrowth Hormone Releasing Hormone
- Packaging10ug
- Price$333
- Updated2021-12-16
- Buy
| Manufacturer | Product number | Product description | Packaging | Price | Updated | Buy |
|---|---|---|---|---|---|---|
| Biorbyt Ltd | orb611697 | GRF (1-44), human | 1mg | $368.9 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb611697 | GRF (1-44), human | 5mg | $935 | 2021-12-16 | Buy |
| Biorbyt Ltd | orb611697 | GRF (1-44), human | 10mg | $1445 | 2021-12-16 | Buy |
| ChemScene | CS-5901 | Humangrowthhormone-releasingfactor | 500ug | $180 | 2021-12-16 | Buy |
| ChemScene | CS-5901 | Humangrowthhormone-releasingfactor | 1mg | $264 | 2021-12-16 | Buy |
| ChemScene | CS-5901 | Humangrowthhormone-releasingfactor | 5mg | $924 | 2021-12-16 | Buy |
| ChemScene | CS-5901 | Humangrowthhormone-releasingfactor | 10mg | $1440 | 2021-12-16 | Buy |
| DC Chemicals | DC23916 | GRF(1-44),human >98% | 10mg | $550 | 2021-12-16 | Buy |
| Usbiological | 208929 | Growth Hormone Releasing Hormone, Human | 250ug | $559 | 2021-12-16 | Buy |
| Usbiological | 154928 | Growth Hormone Releasing Hormone | 10ug | $320 | 2021-12-16 | Buy |
| Usbiological | 154929 | Growth Hormone Releasing Hormone | 10ug | $333 | 2021-12-16 | Buy |
Properties
storage temp. :−20°C
form :powder
color :White to off-white
Water Solubility :Water : 25 mg/mL (4.96 mM)
form :powder
color :White to off-white
Water Solubility :Water : 25 mg/mL (4.96 mM)
Safety Information
| Symbol(GHS): | ||||||||
|---|---|---|---|---|---|---|---|---|
| Signal word: | ||||||||
| Hazard statements: |
|
|||||||
| Precautionary statements: |
|
Description
GHRH is expressed and secreted from the hypothalamic neurons of the arcuate nucleus (ARC). GHRH stimulates the release of growth hormone (GH) in the anterior pituitary. In 1982, three isoforms of GHRH(1–37, 1–40, 1–44 aa residues) were initially isolated from human pancreatic tumors that caused acromegaly, and the latter two were found in the human hypothalamus. The aa sequence of GHRH was also identified in various vertebrates from rodents to fish, including a protochordate. In nonmammalian vertebrates, GHRH-like peptide (pituitary adenylate cyclase-activating polypeptide (PACAP)-related peptide in mammals) was first isolated like GHRH, although the GHRH-like peptide had less activity on GH release. Later, actual GHRH, which was more phylogenetically and structurally similar to mammalian GHRH and showed GH-releasing activity, was isolated in nonmammalian vertebrates.Related product price
- SOMATOSTATIN 28, CYCLIC
$219-1250 - prosomatostatin
$480 - Somatostatin
$110-825
Suppliers and manufacturers
Cellmano Biotech Limited
Alpha Biopharmaceuticals Co., Ltd
Henan Tianfu Chemical Co.,Ltd.
Shenzhen Nexconn Pharmatechs Ltd
Hubei xin bonus chemical co. LTD
Chongqing Chemdad Co., Ltd
SIMAGCHEM CORP
Changzhou Xuanming Pharmaceutical Technology Co., Ltd.
