Product Name | MF | CAS | Details |
---|
Secretin, porcine | C132H224N44O43 | 17034-34-3 | Details |
Substance P 1-7 | C41H65N13O10 | 68060-49-1 | Details |
Secretin (porcine) Hydrochloride | C130H220N44O41 | 17034-35-4 | Details |
Somatostatin-28 1-14 | C61H105N23O21S | 79243-10-0 | Details |
Sarcoma antigen 1 (715-723) | Details |
RGD | C12H22N6O6 | 99896-85-2 | Details |
Secretin (33-59), rat | C129H216N42O42 | 121028-49-7 | Details |
RGD Trifluoroacetate | C??H??F?N?O? | Details |
Substance P (1-7)(TFA) | C??H??F?N??O?? | Details |
Renin Substrate 1 trifluoroacetate salt | C109H156N32O21S | 791068-69-4 | Details |
RGD peptide (GRGDNP) TFA | C??H??F?N??O?? | Details |
Small Cardioactive Peptide B SCPB | C52H80N14O11S2 | 84746-43-0 | Details |
Secretin (human) Hydrochloride | C130H220N44O40 | 108153-74-8 | Details |
Somatostatin-28 1-12 | C49H81N17O19S | 81286-16-0 | Details |
Scrambled10Panx | C58H79N15O16 | 1315378-72-3 | Details |
Relaxin H2 (human) trifluoroacetate salt | C256H408N74O74S8 | 99489-94-8 | Details |
SAMS | C74H131N29O18S2 | 125911-68-4 | Details |
Serine protease hepsin (229-237) | Details |
Succinyl-(Glu9,Ala11·15)-Endothelin-1 (8-21) | C86H117N17O27 | 142569-99-1 | Details |
Scyliorhinin I | C59H87N13O13S | 103425-21-4 | Details |
Sauvagine trifluoroacetate salt | C202H346N56O63S1 | 74434-59-6 | Details |
SEB Domain 144-153 | C50H90N14O17 | 210229-94-0 | Details |
SNAP-25 187-203 | 216568-37-5 | Details |
Sakamototide substrate peptide TFA | C??H???F?N??O?? | Details |
Similar to calgizzarin; similar to PID:g3115349 (40-49) | Details |
Smcy HY Peptide 738-746 | C48H82N18O14S | 207113-06-2 | Details |
Sulforhodamine 101; Sulforhodamine 640 | C31H30N2O7S2 | 60311-02-6 | Details |
Rho guanine nucleotide exchange factor 17 (425-438) | Details |
RER1 protein (80-91) | Details |
Small subunit processome component 20 homolog (626-634) | Details |
Survivin (18-27) | Details |
Staphylococcus Aureus Protein A (SpA)-DerivedPeptide | C68H118N20O22 | 144979-26-0 | Details |
Spadin | C96H142N26O22 | 1270083-24-3 | Details |
SNX 482 | C192H274N52O60S7 | 203460-30-4 | Details |
Rhodamine 101;Rhodamine 640 | C32H31ClN2O3 | 64339-18-0 | Details |
Romidepsin | C24H36N4O6S2 | 128517-07-7 | Details |
Steroidogenesis-Activator Polypeptide | C141H226N34O51 | 108563-23-1 | Details |
Sodium-coupled monocarboxylate transporter 2 (343-356) | Details |
Serine/threonine-protein kinase B-raf (586-614) | Details |
Secernin-1 (196-204) | Details |
Romurtide | C43H78N6O13 | 78113-36-7 | Details |
Somatostatin Acetate | C76H104N18O19S2 | 51110-01-1 | Details |
Rhodopsin Epitope Tag | C??H??N??O?? | Details |
st-Ht31 | C129H217N29O39 | 188425-80-1 | Details |
Super-TDU 1-31 | C???H???N??O?? | Details |
Substance P 1-9 | C52H77N15O12 | 57468-17-4 | Details |
Substance P Acetate | C63H98N18O13S | 33507-63-0 | Details |
SSA protein SS-56 (55-64) | Details |
Rho-related GTP-binding protein RhoC (176-185) | Details |
Serine protease hepsin (191-199) | Details |
Selepressin | C46H73N13O11S2 | 876296-47-8 | Details |
Sphistin Synthetic Peptide(12-38,Fitc in N-Terminal-Fluorescently Labeled Peptide) | C???H???N??O??S | Details |
RGD-4C | C42H60N14O16S4 | 332179-76-7 | Details |
Scyliorhinin II | C77H119N21O26S3 | 112748-19-3 | Details |
sn-Glycero-3-phosphocholine | C8H20NO6P | 28319-77-9 | Details |
Survivin (96-104) | Details |
Serine/threonine-protein kinase mTOR (89-98) | Details |
Survivin (80-88) | Details |
Shepherdin 79-87 | C41H64N12O12S | 861224-28-4 | Details |
Splenopentin Acetate | C33H55N9O11 | 105184-37-0 | Details |
Rusalatide acetate | C99H151N29O37S | 875455-82-6 | Details |
SLLK, Control Peptide for TSP1 Inhibitor(TFA) | C??H??F?N?O? | Details |
Sinapultide | C126H238N26O22 | 138531-07-4 | Details |
Suc-Leu-Leu-Val-Tyr-AMC | C40H53N5O10 | 94367-21-2 | Details |
Ribosomal protein S26 (47-61) | Details |
Small nuclear ribonucleoprotein Sm D1 (11-19) | Details |
Sperm surface protein Sp17 (103-111) | Details |
rGHRH(1-29)NH2 | C???H???N??O??S | Details |
RGD peptide GRGDNP | C23H38N10O10 | 114681-65-1 | Details |
Substance P, Free Acid | C63H97N17O14S | 71977-09-8 | Details |
st-Ht31 P | C127H209N29O39 | 252869-81-1 | Details |
S Tag Peptide | C73H117N23O25S | 7429-70-1 | Details |
Solanezumab | 955085-14-0 | Details |
Structure-specific endonuclease subunit SLX4 (603-615) | Details |
Retinal dehydrogenase 1 (88-96) | Details |
Ribosome-binding protein 1 (879-887) | Details |
Resveratrol | C14H12O3 | 501-36-0 | Details |
Secretoneurin, rat | C28H33NO7 | 149146-12-3 | Details |
Sincalide Ammonium Salt | C49H62N10O16S3 | 25126-32-3 | Details |
Somatostatin-25 | C127H191N37O34S3 | 76461-17-1 | Details |
sgp91 ds-tat Peptide 2, scrambled | Details |
RF9 trifluoroacetate salt | C26H38N6O3 | 876310-60-0 | Details |
Speract | C38H57N11O14 | 76901-59-2 | Details |
Rotigaptide | C28H39N7O9 | 355151-12-1 | Details |
Serine protease hepsin (268-276) | Details |
SDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS | Details |
SIYRY | C50H71N11O13 | 178561-37-0 | Details |
Suc-Arg-Pro-Phe-His-Leu-Leu-Val-Tyr-AMC trifluoroacetate salt | C66H88N14O14 | 76524-84-0 | Details |
Substance P 7-11 | C31H44N6O5S | 51165-05-0 | Details |
Succinyl-(Pro58,D-Glu65)-Hirudin (56-65) (sulfated) | C64H88N10O26S | 131791-98-5 | Details |
Suc-Pro-OH | C9H13NO5 | 63250-32-8 | Details |
Semaglutide | C187H291N45O59 | 910463-68-2 | Details |
Secretin, canine | C131H222N44O41 | 110786-77-1 | Details |
RPL8 protein (31-41) | Details |
Surface IgG (sA20-Ig) of A20 (106-114) | Details |
SPACE peptide | C40H63N15O17S2 | 1621717-95-0 | Details |
RNAIII-inhibiting peptide(TFA) | C??H??F?N??O?? | Details |
SLLK, Control Peptide for TSP1 Inhibitor | C21H41N5O6 | 464924-27-4 | Details |
Suc-Leu-Tyr-AMC | C29H33N3O8 | 94367-20-1 | Details |
Sarafotoxin C trifluoroacetate salt | C103H147N27O37S5 | 121695-87-2 | Details |
Product Total: Product Page: | ||||
34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 |