• 
  

• Name:Exenatide Acetate, Exenatida      
  Cas No:141732-76-5
  Formula: C186H286N50O62S
  Molecular:4246.62
  Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
  Purity:98%
  Appearance: white powder
  Source: synthetic
  Also know as AC 2993, Bydureon, Byetta, Exenatide synthetic, Synthetic exendin-4
  Appearance: White Lyophilized Powder
  Minimum Order Quantity: 1 g
  Brand Name: Yinherb
  Test Method: HPLC
  Storage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18° C. Upon reconstitution of the peptide it should be stored at 4° C between 2-21 days and for future use below-18° C. 

• Exenatide Acetate Benefits
  1. Exenatide augments pancreas response and more appropriate amount of that helps lower the rise in blood sugar from eating.
  2. Exenatide also suppresses pancreatic release of glucagon, which prevents hyperglycemia (high blood sugar levels).
  3. Exenatide helps slow down gastric emptying and thus decreases the rate at which meal-derived glucose appears in the bloodstream.
  4. Exenatide has a subtle yet prolonged effect to reduce appetite, promote satiety via hypothalamic receptors.
  5. Exenatide reduces liver fat content. Fat accumulation in the liver or nonalcoholic fatty liver disease (NAFLD) is strongly related with several metabolic disorders.
  

• 
  

• 
  

HOT SELLING

Semaglutide CAS 910463-68-2

Tirzepatide CAS 2023788-19-2

Retatrutide CAS 2381089-83-2

Liaglutide CAS 204656-20-2

Octreotide CAS79517-01-4

Dulaglutide CAS 923950-08-7

Lixisenatide CAS 320367-13-3

Teduglutide CAS 197922-42-2

Albiglutide CAS 782500-75-8

Degarelix CAS 214766-78-6

Cilengitide CAS 188968-51-6

Mifamurtide CAS 83461-56-7

Somatostatin CAS 51110-01-1

Exenatide Acetate CAS 141732-76-5

Pramlintide CAS 151126-32-8

Eptifibatide CAS 188627-80-7

Bivalirudin CAS 128270-60-0

Semax CAS 80714-61-0

Contact information