AMYLIN (8-37) (RAT)
| Price | $7 |
| Package | 1KG |
| Min. Order: | 1KG |
| Supply Ability: | 100kg |
| Update Time: | 2020-02-14 |
Product Details
| Product Name: AMYLIN (8-37) (RAT) | CAS No.: 138398-61-5 |
| Min. Order: 1KG | Purity: 99% |
| Supply Ability: 100kg | Release date: 2020/02/14 |
| Name: Judy Liang |
Product Name: AMYLIN (8-37) (RAT)
Synonyms: Amylin (8-37) (mouse, rat) H-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2;AMYLIN (8-37) (RAT);ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2;H-ALA-THR-GLN-ARG-LEU-ALA-ASN-PHE-LEU-VAL-ARG-SER-SER-ASN-ASN-LEU-GLY-PRO-VAL-LEU-PRO-PRO-THR-ASN-VAL-GLY-SER-ASN-THR-TYR-NH2;diabetes associated peptide amide*fragment 8-37 R;Amylin (8-37) (mouse, rat);Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Arg-Ser-Ser-Asn-Asn-Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2
CAS: 138398-61-5
MF: C140H227N43O43
MW: 3200.56
EINECS:
Product Categories: Peptide
Mol File: 138398-61-5.mol
AMYLIN (8-37) (RAT) Structure
AMYLIN (8-37) (RAT) Chemical Properties
storage temp. -15°C
Company Profile Introduction
Established in 2014,Career Henan Chemical Co. is a manufacturerspecializing in the sale of fine chemicals.
Mainly deals in the sales of:
Pharmaceutical intermediates
OLED intermediates：
Pharmaceutical intermediates;
OLED intermediates;
You may like
Recommended supplier
| Product name | Price | Suppliers | Update time | |
|---|---|---|---|---|
| $0.10/1kg |
VIP2Y
|
Zibo Hangyu Biotechnology Development Co., Ltd
|
2024-01-05 | |
| $0.00/10mg |
VIP1Y
|
Moxin Chemicals
|
2025-01-03 | |
| $178.00/1mg |
VIP3Y
|
TargetMol Chemicals Inc.
|
2024-11-19 | |
| $150.00/1kg |
VIP1Y
|
Hebei Zhuanglai Chemical Trading Co Ltd
|
2024-11-14 |
China- Since: 2014-12-17
- Address: Room 702, Floor 7, Building 10, National University Science Park, High-Tech Zone, Zhengzhou City, H
INQUIRY