Sermorelin
Price | $8 |
Package | 1Kg/Bag |
Min. Order: | 1Kg/Bag |
Supply Ability: | 20 Tons |
Update Time: | 2020-11-16 |
Product Details
Product Name: Sermorelin | CAS No.: 86168-78-7 |
EC-No.: 1312995-182-4 | Min. Order: 1Kg/Bag |
Purity: 99% | Supply Ability: 20 Tons |
Release date: 2020/11/16 |
Product Name: | Sermorelin |
Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN) |
CAS: | 86168-78-7 |
MF: | C149H246N44O42S |
MW: | 3357.88 |
EINECS: | 1312995-182-4 |
Product Categories: | Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors |
Mol File: | 86168-78-7.mol |
Sermorelin Chemical Properties |
alpha | D20 -63.1° (c = 1 in 30% acetic acid) |
storage temp. | −20°C |
CAS DataBase Reference | 86168-78-7(CAS DataBase Reference) |
Company Profile Introduction
Longyan Tianhua Biological Technology Co., Ltd is located in Longyan city, Fujian Province, China. It is a large-scale high-tech integrated enterprise dedicated to the research, development and sales of fine chemicals, pharmaceutical raw material intermediates, food and feed additives.
The company has its own research and development base, equipped with advanced production equipment and efficient and precise testing instruments, has set up a strict and scientific quality management system, and constantly committed to technological innovation, product innovation and management innovation, so as to ensure that our products have super competitiveness in the same industry.?
Company's main: Phenformin Hydrochloride, Chlorhexidine Acetate, Indomethacin Biphenyl benzyl azole dyclonine hydrochloride clorprenaline hydrochloride griseofulvin chloramphenicol maleic acid to guangxi pp qi, fucus xanthine tert-butyl of hydroxy anisole (BHA), ammonia, benzene pteridine zonisamide moxifloxacin mother nucleus moxifloxacin side chain moxifloxacin hydrochloride clobetasol propionate tranexamic acid raw material, and so on.?
The annual sales volume of the company is around 3 million DOLLARS. Its products have been sold to more than 40 countries and regions all over the world, and have been well received. Moreover, the buyback rate of customers is very high.
Longyan Tianhua Biotechnology Co., LTD. Is looking forward to long-term cooperation with you.
You may like
Recommended supplier
Product name | Price | Suppliers | Update time | |
---|---|---|---|---|
$10.00/1kg |
VIP1Y
|
Hebei Ganmiao New material Technology Co., LTD
|
2024-06-05 | |
$0.00/1Gram |
VIP1Y
|
Hangzhou Hyper Chemicals Limited
|
2024-04-29 | |
$20.00/1box |
VIP1Y
|
Shanghai Getian Industrial Co., LTD
|
2024-04-26 | |
$10.00/1mg |
VIP1Y
|
Hebei Kangcang new material Technology Co., LTD
|
2024-03-29 | |
$10.00/1mg |
Nantong Guangyuan Chemicl Co,Ltd
|
2024-01-17 | ||
$0.00/1kg |
VIP1Y
|
Shandong Hanjiang Chemical Co., Ltd
|
2024-01-10 | |
$36.00/1box |
VIP2Y
|
Hebei Xunou new energy Technology Co., LTD
|
2024-01-09 | |
$100.00/10g |
Zhejiang Hangyu API Co., Ltd
|
2023-12-14 | ||
$35.00/1Box |
zhuzhou dingcheng meihei comestic co.,ltd
|
2023-12-06 | ||
$0.00/1kg |
Hebei Xinsheng New Material Technology Co., LTD.
|
2023-10-18 |
- Since: 2019-10-11
- Address: Room 201, 11 Xinhouying Road, Xicheng Lian, Xinluo District, Longyan City, Fujian Province, China
INQUIRY