Identification | Back Directory | [Name]
Exendin-3 (9-39) amide | [CAS]
133514-43-9 | [Synonyms]
EXENDIN (9-39) EXENDIN 3 (9-39) EXENDIN (9-39) AMIDE EXENDIN FRAGMENT 9-39 EXENDIN [9-39] PEPTIDE EXENDIN-3 (9-39) AMIDE Exendin (9-39) Acetate Exendin 4 (9-39) amide Exendin FragMent 9-39Exendin M.W. 3369.79 C149H234N40O47S Exendin-3 (9-39) amide USP/EP/BP Exendin Fragment 9-39 >=95% (HPLC) 9-39-Exendin 3(Heloderma horridum) DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 EXENDIN FRAGMENT 9-39;EXENDIN (9-39) 9-39-Exendin 3(Heloderma horridum) (9CI) H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 H-ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2 Asp-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRp-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2, ≥95%(HPLC) H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 acetate salt ASP-LEU-SER-LYS-GLN-MET-GLU-GLU-GLU-ALA-VAL-ARG-LEU-PHE-ILE-GLU-TRP-LEU-LYS-ASN-GLY-GLY-PRO-SER-SER-GLY-ALA-PRO-PRO-PRO-SER-NH2: DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 Exendin 3 (heloderma horridum), 1-de-L-histidine-2-de-L-serine-3-de-L-aspartic acid-4-deglycine-5-de-L-threonine-6-de-L-phenylalanine-7-de-L-threonine-8-de-L-serine- L-Serinamide, L-α-aspartyl-L-leucyl-L-seryl-L-lysyl-L-glutaminyl-L-methionyl-L-α-glutamyl-L-α-glutamyl-L-α-glutamyl-L-alanyl-L-valyl-L-arginyl-L-leucyl-L-phenylalanyl-L-isoleucyl-L-α-glutamyl-L-tryptophyl-L-leucyl-L-lysyl-L-asparaginylglycylglycyl-L-prolyl-L-seryl-L-serylglycyl-L-alanyl-L-prolyl-L-p... | [Molecular Formula]
C149H234N40O47S | [MDL Number]
MFCD02179664 | [MOL File]
133514-43-9.mol | [Molecular Weight]
3369.76 |
Chemical Properties | Back Directory | [density ]
1.51 | [RTECS ]
LF2460000 | [storage temp. ]
Keep in dark place,Inert atmosphere,Store in freezer, under -20°C | [solubility ]
H2O : 50 mg/mL (14.84 mM; Need ultrasonic) | [form ]
Solid | [color ]
Off-white to pale purple | [Water Solubility ]
Soluble in water at 1mg/ml | [InChIKey]
WSEVKKHALHSUMB-UHFFFAOYSA-N |
Hazard Information | Back Directory | [Description]
Exendin-3 (9-39) amide is a truncated form of the exendin-4 (Item No. 11096) peptide that acts as a potent competitive antagonist for the glucagon-like peptide 1 receptor (GLP-1R; Kd = 1.7 nM in CHL cells transfected with cloned human GLP-1).1 It inhibits exendin-3-induced increases in cAMP levels in guinea pig pancreas cells (IC50 = 20 nM).2 Exendin-3 (9-39) amide administration in the hypothalamus (10 and 100 μg, i.c.v.) reverses GLP-1 inhibition of feeding behavior in rats.3 | [Uses]
Biological probe. | [Uses]
Exendin-3 (9-39) is a potent and selective GLP-1 receptor antagonist. | [General Description]
Exendin Fragment 9-39 is an antagonist of glucagon-like peptide-1 (GLP-1) receptor, and also acts as an inhibitor of glucosedependent insulinotropic polypeptide (GIP)-receptor binding. It also prevents the production of cAMP by GIP. GLP-1, along with GIP, acts as a physiological incretin. | [Biochem/physiol Actions]
GLP-1 (glucagon-like peptide-1) receptor antagonist. Competitive inhibitor of exendin-3 and exendin-4. | [storage]
Desiccate at -20°C |
|
|